PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G142300.1
Common NameB456_006G142300, LOC105799545
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 687aa    MW: 75514.7 Da    PI: 9.8266
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G142300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.13.2e-111044136
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS- CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRt 36
                        ++ W t+E++ll++av+++G+++W+++a +++ +Rt
  Gorai.006G142300.1 10 KQTWGTWEELLLACAVHRYGNNSWDSVAMELQ-KRT 44
                        789*****************************.999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007172.9E-7967IPR001005SANT/Myb domain
SuperFamilySSF466893.67E-5966IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-41045IPR009057Homeodomain-like
PfamPF002493.7E-101045IPR001005SANT/Myb domain
CDDcd001671.26E-61265No hitNo description
Gene3DG3DSA:1.20.920.103.9E-13288421IPR001487Bromodomain
SMARTSM002971.4E-15300409IPR001487Bromodomain
SuperFamilySSF473703.27E-16306411IPR001487Bromodomain
PfamPF004395.3E-10314393IPR001487Bromodomain
CDDcd043691.42E-13314404No hitNo description
PROSITE profilePS5001413.686319390IPR001487Bromodomain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 687 aa     Download sequence    Send to blast
MAKHHSFPEK QTWGTWEELL LACAVHRYGN NSWDSVAMEL QKRTSTFQHL FFTPLSCQQK  60
FQDLKRRFAE NGDDGETTNN NISTSTVPWL DELRRLRVAE LRREVQQYDL SIVSLQMKVQ  120
KLKEEREQSL TENGKETEKS DLEREKGSEK KEENETENIT RRPVNGREES ERENHSVNES  180
NSTDPKEESP GTGPDEAKVE PEPVEPDGGE TGKEVQSVKP GGEASCNGSC DSVAKGSAEN  240
SERVDPRETG DSPESVAESK GEEPNRESSD VQSSASLSGK EKKNAEPDEP DNGELDQSLS  300
IKKVSVESQP LVALLDIFRS HKLGSLFERR LEIQKTPDYS NLIRQHLDLE TIGMRVEEGW  360
YSGCKSKFFR DLLLLLTNAI IFFGKESSEY AAAIEFRQLV SKEIRTQFRN SSVLPKEQSS  420
SRVPESQMPL KPEPQLSLSL SMKPKLSVPL IACRKRSSIA AKSSTSSSGQ EKKRQLLASL  480
MNEKPALGWK QHDKSTEESP VAKKRTRESS ASGSRKASKN AKARSNTNTN KNPGTNTNAA  540
ISSKGGSSND NSESKGGEKE KSNSKTASSK KPSAANFLNR MRSSLSGNEP LTETLKGVIS  600
SGKGKGGGDA GEHKKSSASC KGDQQKDRTP TPRTRSGGKR TSPAKRSTGR PPKRVPATQS  660
APPGKRGREA VENHSGGGQA KKRSRK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5802541e-99JX580254.1 Gossypium hirsutum clone NBRI_GE12650 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012485627.10.0PREDICTED: myb-like protein X
TrEMBLA0A0D2NSQ10.0A0A0D2NSQ1_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65302539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57980.11e-87DNA-binding bromodomain-containing protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]